The 10 Best Web Design Agencies in Miami (2024)

Best Web Design Agencies in Miami

Featured providers

  • Universal Design Labs

    Universal Design Labscertified-flagverified-flagfeatured-flag

    4.6
    (2 reviews)

    Taking your business to a new height!

    Recommended
    Award-winner
    At Universal Design Labs , we prioritize our customers and focus on delivering high-quality results that are beyond satisfactory. Our dedicated teams help us to achieve soaring sales figures, rise in customers and establishing online presence which is essential for any business. We excel at converting basic ideas into visionary brand concepts for our clients. With an innovative, methodical process of product development, we aim to deliver outstanding digital marketing services that are in line with what our customers require
    4 works in Website Creation
    Active in Miami, United States
    From €500 for Website Creation
  • Brightscout

    Brightscoutcertified-flagverified-flagfeatured-flag

    5
    (1 review)

    Transforming the World's Most Innovative Businesses with Uniquely Crafted Brands and Standout Apps.

    Award-winner
    Brightscout is a global branding and app development studio built from the best talent in the world. We strive to transform the world’s most innovative businesses through a powerful mix of exquisite design, development, and strategy solutions. We partner with leaders and entrepreneurs at critical inflection points to help them better connect and engage with their customers. Together we build brands, products, and all the digital experiences in between to support growth in competitive markets.
    1 work in Website Creation
    Active in Miami, United States
    From €25000 for Website Creation
  • Minsite

    Minsitecertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    Designing Web Experiences That Wow

    Recommended
    Award-winner
    We are Minsite, a web design agency from New York. We create amazing websites that captivate and convert visitors into customers and sales. Whether you need a website for your business, a blog, or an online store, we are here to make it possible. At Minsite, simplicity is the key to a memorable web experience. Simplicity is a philosophy that permeates everything we do. We believe in clarity, transparency, and honesty in communication with all our clients and project management. The name Minsite is a combination of minimalism and ‘website.’ We draw inspiration from minimalism as a philosophy of life that we deeply value. We are committed to bringing this philosophy to every project we undertake, making the process of working with us easier and more enjoyable.
    5 works in Website Creation
    Active in Miami, United States
    From €10000 for Website Creation
  • Dot Com Development

    Dot Com Developmentcertified-flagverified-flagfeatured-flag

    5
    (7 reviews)

    On Time ... On Budget ... Solutions Exceeding Expectation

    Recommended
    Award-winner
    Dot Com Development is a and awarded and top software development & IT consulting company offering innovative solutions for diverse industry verticals. We strive to be an invaluable catalyst for building a culture of innovation. Our breakthrough web and mobile solutions have the capability to challenge the limits and give business a competitive edge. Our services include Strategic Planning and Consulting UX/UI Design Prototyping and POC's Web Application Development Mobile Application Development eCommerce / mCommerce Development Cloud Development CRM / ERP Development AI/ML Development DevOps Services
    6 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Web Design Glory

    Web Design Glorycertified-flagverified-flagfeatured-flag

    4.9
    (33 reviews)

    "Rising Brands for Digital Glory!"

    Recommended
    Award-winner
    Web Design Glory is a professional web design and development agency that offers a wide range of services to help businesses establish a strong online presence. Our team of experienced designers and developers works closely with clients to understand their unique needs and create customized solutions that meet their specific requirements. Our services include Website Design, Web Development, Mobile Application, Branding Solutions, Digital Marketing, Domain & Hosting, Video Animation & Content Creation. We specialize in creating modern, responsive websites optimized for search engines and providing a great user experience. Our web development services include e-commerce solutions, content management systems, and custom web applications. At Web Design Glory, we are dedicated to providing high-quality services that deliver results. Contact us today to learn more about how we can help your business succeed online.
    5 works in Website Creation
    Active in Miami, United States
    From €186 for Website Creation
  • Darkside by Ben Walsh

    Darkside by Ben Walshcertified-flagverified-flagfeatured-flag

    4.6
    (4 reviews)

    Fixing F🤬cked Up Brands and Websites Fast

    Recommended
    Award-winner
    Armed with our zero-bullsh*t framework, clear communication and lean design approach, we transform your business in weeks. Branding: Develop a brand strategy and create an identity that resonates with your audience. Websites: Design and build your website using Webflow. We also use our 20 years in tech to help your software look its best and deliver a solid experience to your users. UX Roadmap Audit: Evaluate the state of your Product's UX and UI. UX Design Sprint: 30 days of Unlimited UX and UI design support from a team of experts.
    3 works in Website Creation
    Active in Miami, United States
    From €1200 for Website Creation

Best Web Design Agencies in Miami

Sort by
  • Alfatek Digital

    Alfatek Digitalverified-flagfeatured-flag

    4.8
    (2 reviews)

    ATD is an agency committed to bringing brands to life

    Recommended
    A Data-Driven Creative Digital Marketing Agency Focused on Delivering Real Results, Alfatek Digital (ATD) is a premium digital marketing company comprised of a team of creative designers, skillful developers, and top-notch digital marketing specialists. We offer tailor-made websites and digital marketing solutions that help you identify, reach out and engage with your target audience in unique ways. Leveraging the knowledge and experience of our team, we strategically build and share the brand story that is a true reflection of your values and business. Moreover, we increase your brand visibility, boost traffic, generate leads and sales while building loyalty through our cutting-edge digital marketing strategy. Through our innovative digital results, we put your brand on the top of your game.
    3 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Spectra Studio

    Spectra Studiocertified-flagverified-flagfeatured-flag

    (0 review)
    Website Design ☆ Logo Design ☆ Social Media Marketing > Logo Design and Branding Packages > Website Design Packages: Sample OnRouteTowing . ca or DezinerOptix . com > Website Video Spokesperson Packages > Search Engine Optimization Packages > Social Media Marketing Packages > Website and Email Hosting Packages Spectra Studio is a leading graphic design company rated highly in the design industry for creative web graphic design solutions , brand identity, web design, and website development. We are a world-renowned graphic design company bringing all design experts in the field to work and achieve excellent results for your design needs. Our graphic design team specializes in building brand recognition to ensure that your company or product stands apart from your competition. From small start-up companies in need of logo design and branding collaterals such as brochures and business cards to Medium and Large Companies searching for the right web design and development agency to handle their complete web design solution and marketing campaign -- Spectra Studio will deliver!!
    7 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Lightspace

    Lightspaceverified-flagfeatured-flag

    (0 review)

    We help brands launch and grow through technology and design.

    We are a US-based design and development agency working on projects around the world. We support businesses of all sizes throughout their journey from idea to launch, or by helping them elevate their business and scale. Our team is an international blend of creatives and tech experts, specializing in branding, design and development services.
    7 works in Website Creation
    Active in Miami, United States
    From €3000 for Website Creation
  • Absolute Web

    Absolute Webverified-flagfeatured-flag

    5
    (2 reviews)
    Award-winner
    Our name really tells you everything you need to know, Absolute Web is a Creative Digital Commerce Agency, established in 1999, providing your business with results in absolutely any aspect of marketing. A highly skilled team comprised of web designers and developers, e-commerce managers, content creators and marketing experts with years of experience in the industry, are ready to grow businesses across many platforms and industries. Led by an entrepreneurial spirit, we treat every client’s business as our own. Taking the time to fully immerse ourselves in their respective industry by identifying competition, trends, failures, and successes is key to working with our clients to developing tailor-made strategies that produce results. Absolute Web is a full-service agency with strong abilities in ecommerce development and management as well as marketing, photography, video and content creation. Based in Miami, we specialize in custom development of Ecommerce Solutions on Magento, Shopify & BigCommerce platforms, informed by strategy and guided by our client’s goals we utilize all of our assets and expertise to ensure results.
    3 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • wdmarketingdigital

    wdmarketingdigitalverified-flagfeatured-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    1 work in Website Creation
    Active in Miami, United States
    From €400 for Website Creation
  • Gig Miami

    Gig Miamiverified-flagfeatured-flag

    (0 review)
    Award-winner
      We are experts in the branding and e-commerce field, with a holistic focus on fashion, lifestyle, and wellness specialized brands. Our ambition is to cultivate a highly successful and integral brand experience to meet all of your business needs. At Gig Miami, we believe your business goals should be in alignment with well-crafted and effective digital communication. It is our promise to you that all of the services you require to promote your brand will be provided with expertise, love, and dedication that stands the test of time.   64% of consumers say that shared values are the main reason that they have a trusted relationship with a brand. Do you know if your website and marketing materials are truly aligned with your brand’s values? Running marketing campaigns or employing new strategies without getting your branding right first is like shouting at a brick wall. Why? Because your ideal customers aren’t going to listen if your brand doesn’t resonate with them. Branding is everything in business - especially in fashion. When done right, it allows you to connect with your ideal customers who identify with your brand values and aesthetic.   My expertise is to help brands create a beautiful visual identity with compelling messaging that communicates their brand’s values and connects them with their ideal customers, all without the big price tag that often comes along with it. If you’re open to learning more, let’s talk. Book a call with me and receive a free brand audit: https://calendly.com/gigmiami   Services,    Web design. Design and develop a website using Modern fonts. Up to 6 designed Squarespace pages Custom CSS added Responsive design Basic SEO added to website Graphics   Responsive E-commerce Design Design and develop a Flagship E-commerce Customized design for a unique brand experience Custom CSS Responsive design SEO added to website Curated Images & Graphics We have a strong experience with Shopify, Magento...   Full Branding Experience Brand Strategy Logo design Copywriting - Mission, Vision, Values Social media graphics, newsletter design, business cards Brand guideline PDF
    2 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • 3 Pixels Media

    3 Pixels Mediacertified-flagverified-flagfeatured-flag

    5
    (1 review)
    3 Pixels Media es un equipo altamente experimentado de creativos, diseñadores y programadores en constante búsqueda de desafíos para impulsar el entorno digital. En los últimos 9 años, hemos entregado con éxito cientos de aplicaciones de vanguardia, lo que nos ha permitido obtener una gran cantidad de conocimientos y experiencia. El equipo de 3 Pixels Media se enorgullece de su filosofía de desarrollo ágil; Una Metodología Flexible que nos ayuda constantemente a cumplir plazos de entrega cortos a la vez que proporciona a nuestros clientes la máxima flexibilidad y rentabilidad.      
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • AVS Cyber

    AVS Cybercertified-flagverified-flagfeatured-flag

    (0 review)
    AVS Cyber Web Design – Vietnam Technical Horsepower Backed By  US Market Experts . AVS Cyber is an American branding and design agency based Saigon (Ho Chi Minh City), Vietnam. We love to deliver simple, effective and professional online solutions that help growing businesses and we always keep our core objective – to DELIVER – front and center. Understand the  “Why, When, And How”  Questions At  AVS Cyber , there are NO “formulaic” solutions because no two businesses are exactly the same. We begin by gathering information from you to understand your business goals, its current market position, the competition... everything we can learn to create a successful strategy and action plans that fits  YOUR unique business and YOUR unique goals.
    1 work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Cheers Visual Communications

    Cheers Visual Communicationscertified-flagverified-flag

    (0 review)

    Powerful Visual Creations

    Design Agency Specializing in Branding, Web Design, Corporate Photography, Corporate Video, Print Design
    1 work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Foonkie Monkey

    Foonkie Monkeyverified-flag

    (0 review)
    Award-winner
    We love innovation! With more than nine years of experience in App development and custom software development, we found that it all starts with a good idea. A powerful one, looking for a change in the behavior of people through creativity, teamwork, and perseverance. We create innovative, beautiful, intuitive, and brilliant products. To get there, we realized that every part of the team must be considered as a really important ingredient to accomplish a product that reflects enthusiasm, compromise, heart, creativity, and enjoyment. In consequence and as our main goal, every single fellow realizes that all the time we spend together is not what usually is known as a job. App development and Custom Software Development is our passion We are three main teams: First, the technology team where the project managers, developers, architects, and IT specialists create innovative solutions of high quality for all challenges proposed. Second, the Art team’s daily labor is a pursuit of creativity, great user experience, and beauties in the design of the solutions. Every day is a discovery of new ideas and challenges. And last but not least, the digital marketing team creates great strategies helping new projects be well known for all targets defined for each product.  
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • MObeats

    MObeatscertified-flagverified-flag

    (0 review)
    We love solving problems while creating cutting-edge products and innovative experiences We love helping companies achieve their business goals and make great relationships with their users through purpose-data driven methodologies with custom technologies.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Soy Leo de MobAppCreator y estamos más que felices porque lanzamos un upgrade de nuestra plataforma. MobAppCreator es la solución más avanzada para crear aplicaciones móviles nativa, incluye content management actualizaciones automáticas y mucho más! Tenemos una excelente propuesta marca blanca para agencias y resellers. Si están interesados en complementar su cartera de productos, podemos coordinar una meet para presentarles la plataforma y evacuar dudas. No dudes en escribirme. Saludos Leo Pasquini leo@mobappcreator.com https://MobAppCreator.com
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Digismart

    Digismartcertified-flagverified-flag

    (0 review)

    Smart Web Development and Digital Marketing for Entrepreneurs

    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • DPL

    DPLverified-flag

    (0 review)

    Innovation as a Service

    DPL is one of the leading software development and IT companies around the world. Established in 2003, DPL serves customers in all major regions emphasizing most on Europe, Middle East and Americas. The company is based in Islamabad, Pakistan with its regional offices located in USA and Sweden. DPL is the pioneer in Agile practices and innovation culture in Pakistan. The company has been recognized globally in various magazines and rankings for its unparalleled workplace environment. The flat culture and holacratic approach encourage employees to work devotedly and stimulate innovations in the process. Clients from a wide range of industries including, but not limited to Healthcare, Fintech, Automotive, Mobility, Telco, Education, Media and E-commerce make a highly diverse portfolio at DPL. The services primarily include Digital Transformation, Product Engineering, IT Strategy & Consulting, and Custom Software Development. DPL leadership plays a crucial part in restructuring of the IT sectors in various regions of the world. The members of the executive team serve at the core of policy making and implementation of #DigitalPakistan campaign. DPL also hosts annual Agile Conference and serves to disseminate the knowledge and best practices in Agile transformation. Let's talk to identify the areas of mutual growth and collaboration.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Condor Agency

    Condor Agencycertified-flagverified-flag

    (0 review)
    No work in Website Creation
    Active in Miami, United States
    From €3000 for Website Creation
  • Agencia Digital AMD

    Agencia Digital AMDcertified-flagverified-flag

    (0 review)

    Como agencia digital líder en el mercado, innovamos, escuchamos, entendemos, investigamos y analizam

    Como agencia digital líder en el mercado, innovamos, escuchamos, entendemos, investigamos y analizamos con métodos y herramientas. Combinamos creatividad y conocimiento técnico. Somos un puente ideal de apoyo entre nuestros clientes y su público objetivo, para llegar así con la mayor eficiencia posible.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Ndimension Labs

    Ndimension Labscertified-flagverified-flag

    (0 review)
    Ndimension Labs helps re-imaging innovation by offering customized solutions in mobile & web apps, software and digital solutions. Revamping your digital solution capabilities with features that brings your business to the forefront. We help organizations transform data into real-world intelligence.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • CayMedia

    CayMediacertified-flagverified-flag

    (0 review)

    We are dedicated to you and your businesses needs!

    We’re a full-service Marketing Agency focused on creative solutions that get results. Our purpose is to help brands and businesses define and tell their story, through the best strategy, creative direction, – all with the intention of increasing their bottom line and awareness.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • No work in Website Creation
    Active in Miami, United States
    From €100 for Website Creation
  • Egochi Miami SEO Agency

    Egochi Miami SEO Agencycertified-flagverified-flag

    (0 review)

    Let's Grow Together

    Egochi Miami SEO Agency stands as a beacon of digital excellence in the heart of Miami, offering a comprehensive suite of SEO and web design services. As a full-service digital marketing powerhouse, we merge data-driven SEO tactics with innovative web aesthetics to amplify online visibility. Drawing from the vibrant energy of Miami's digital landscape, Egochi strives to elevate brands by crafting bespoke strategies that resonate with topical authority and semantic precision.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Mission Morph

    Mission Morphcertified-flagverified-flag

    (0 review)

    Leading Your Business through a Digital Metamorphosis

    Mission Morph is a full-service Miami-based digital marketing agency that excels in delivering comprehensive digital solutions tailored to your needs. Our agency offers a comprehensive suite of services including Web Development, Web Design, Branding and Search Engine Optimization. Starting with Web Development, our proficiency extends to crafting sophisticated and functional websites. From dynamic static websites that establish a robust online presence to immersive e-commerce platforms, we ensure your digital infrastructure aligns seamlessly with your business objectives. At Mission Morph, design is both art and expansion. Our Web Design team meticulously curates visual identities that transcend aesthetics. We understand that a compelling design is not just visually appealing but also communicates your brand essence effectively. When it comes to Branding, we go beyond logos - we create visionary brand marks. Our branding services encompass a strategic approach to developing a brand identity that resonates with your target audience. From brand strategy to execution, Mission Morph is your partner in brand elevation. With more than 8+ years in Local SEO, our team is proficient in optimizing your digital footprint to stand out in local searches, enhancing visibility and attracting potential customers in your vicinity. Driving more organic traffic to your location and improving local rankings translates to new customers and more opportunities to convert. To broaden your digital footprint, we do recommend combining it with our Organic SEO services, where we deploy advanced strategies to improve your search engine rankings by revisiting your meta data, website content and keywords ensuring that your business is easily discoverable by both local and global audience. Your digital narrative takes center stage with Mission Morph. Engage with us for a transformative journey where innovation converges with impact. Visit Mission Morph to explore the full spectrum of our services.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Godiggo

    Godiggocertified-flagverified-flag

    (0 review)

    Elevate your brand with Godiggo: Where stunning design meets cutting-edge development.

    Discover expert web design and development at Godiggo, where innovation meets functionality. Based in the USA, we specialize in crafting bespoke, responsive websites that are both visually striking and optimized for performance. Elevate your digital presence and engage customers effectively. Connect with us to start your journey toward digital excellence!
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Bangluxor

    Bangluxorcertified-flagverified-flag

    4.9
    (5 reviews)

    Top UX UI web design

    Recommended
    Award-winner
    Bangluxor se ha convertido en un líder de experiencias digitales, diseño web y marca. Somos una marca global con una promesa: Soluciones creativas del mañana: hoy. Trabajamos globalmente con el apoyo de clientes en seis países. Trabajamos día a día para que personas y empresas formen parte de la familia Bangluxor en el mundo de los negocios digitales. Nuestra visión está enfocada en marcar la diferencia en cada proyecto como resultado de un diseño exclusivo pensado y único acorde a las tendencias actuales del mercado que refleje el valor de cada uno de nuestros clientes.
    5 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Branex LLC

    Branex LLCcertified-flagverified-flag

    5
    (2 reviews)

    Transforming Visions into Code!

    Recommended
    Branex is a top-of-the-line digital transformation company, dedicated to enriching lives by providing innovative and ingenious solutions to small and large-scale businesses. Every day, we strive to assist you in augmenting your brand’s online visibility, enhancing efficiencies, reducing operational costs and eventually driving sales and ROI. What does it mean working with Branex? Minimalistic Design 50% Faster Development Enterprise Enabled App Compliance Driven App Seamless Back-End Integration Smooth Deployment Strict Quality Assurance Post-Deployment Support And most importantly, we are with you till the end! Your satisfaction remains our top priority because we believe in quality, not quantity. Our team accepts only limited projects at a time, and deploys dedicated resources to work on each, thereby accelerating the process without compromising quality. Mobile app design Enterprise app development, M-commerce app development Mobile app maintenance Mobile application consultation iPad and tablet software development Our team is based on experienced iOS and Android mobile app developers in USA, who develop mobile applications with pioneering technologies. Be it an Android app development or iOS, a hybrid app or a native application, we deal in all kinds of mobile application development.
    6 works in Website Creation
    Active in Miami, United States
    From €3000 for Website Creation
  • Liss Solutions

    Liss Solutionscertified-flagverified-flag

    5
    (4 reviews)

    Empowering Your Digital Journey with Innovative Solutions.

    Recommended
    Award-winner
    Liss Solutions is a dynamic company that offers a wide range of digital services to clients all over the world. Our team of skilled professionals is dedicated to providing top-quality services in web design and development, software design and development, social media management, graphic design, virtual assistance, and data entry. We pride ourselves on our ability to work collaboratively with our clients to create custom solutions that meet their specific needs and exceed their expectations. With years of experience in the industry, we have the knowledge and expertise to help our clients achieve their goals and grow their businesses. At Liss Solutions, we are committed to delivering outstanding results and building long-lasting relationships with our clients. Contact us today to learn more about how we can help you achieve your digital goals.
    3 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • We believe in collaboration, diverse perspectives, pushing the envelope, and clear-cut solutions. And a lot of laughs along the way. We’re the ride-or-die creative team that will always empower you—and tell the truth about what will empower your organization. Our small, agile team is deeply connected. We bring our insight and unique POV to each and every project, as the seats at the LUMI table represent women from the Black and LGBTQIA+ communities. We know everything changes at lightning speed, and we’re here to be your marketing partner (or your marketing department) as your business grows.
    2 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Pow Ideas - Agencia de Publicidad

    Pow Ideas - Agencia de Publicidadcertified-flagverified-flag

    5
    (32 reviews)

    Diseño y desarrollo de proyectos de branding

    Recommended
    Award-winner
    Nos hemos convertido en aliados estratégicos de organizaciones de diversas índoles a nivel global gracias a un equipo multidisciplinario que usa la creatividad y la tecnología para crear marcas con propósito . Contamos con más de 200 proyectos integrales en más de 18 países; ofreciendo un servicio integral personalizado a cada marca.
    8 works in Website Creation
    Active in Miami, United States
    From €200 for Website Creation
  • Market Media Connect Inc. aims to deliver all-out digital marketing solutions to corporations, niches, and investors. With experts that have decades of experience combined, Market Media Connect Inc. is unique in its nature as the sole agency that works on a deep-rooted and personal level with all its clients. Market Media Connect Inc. provides digital solutions to many industries like Investor Relations, Analytical Reporting, and even to Doctors and Lawyers. Bridge the gap between innovation and success with Market Media Connect Inc.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • yoursite.com

    yoursite.comcertified-flagverified-flag

    (0 review)
    Создайте веб-сайт и подключитесь к миру. Запустите свой сайт и выходите в Интернет прямо сейчас! Все планы включают индивидуальные почтовые ящики и веб-хостинг. Более 200 великолепных шаблонов:  Выбирайте из 200+ потрясающих шаблонов веб-сайтов, которые упрощают создание сайта. Просто выберите дизайн, добавьте в него свои лучшие изображения, добавьте значки социальных сетей, просмотрите и опубликуйте его. Все шаблоны имеют простой интерфейс перетаскивания. Создавайте захватывающие галереи:  Ошеломляйте и привлекайте посетителей бесплатными стоковыми изображениями или добавьте свои собственные фотографии в высоком разрешении с помощью нашего простого виджета галереи. Продемонстрируйте изображения особых событий, трудовой этики, проектов и многое другое, чтобы запечатлеть культуру вашей компании и поделиться ею со всем миром.  Простой инструмент для импорта веб-сайтов: У вас уже есть сайт? Перенесите его в считанные минуты с помощью нашего простого инструмента импорта. Дайте ему новый дом с функциями по требованию , как фри изображений, мобильных людей темы ,  и многое другое. Сделайте свой сайт неотразимым с помощью великолепных шаблонов и раскройте весь его потенциал уже сегодня! Будьте королем социальной активности:  Не просто взаимодействуйте, будьте королем взаимодействия, подключив все свои любимые платформы, такие как Facebook, Twitter, Pinterest, LinkedIn, Flicker и другие. Подключайтесь, привлекайте и увеличивайте число своих подписчиков с помощью встроенных значков социальных сетей и кнопок обмена. Позвольте людям влюбиться в неотразимые услуги вашего сайта. Самый быстрый способ создания сайтов электронной коммерции . Ваш магазин за считанные минуты.  Создайте свой интернет-магазин в кратчайшие сроки! Просто выберите понравившийся шаблон электронной коммерции, добавьте впечатляющий каталог, панель поиска и начните продавать уже сегодня! 30+ платежных шлюзов: Включите безопасные платежные шлюзы, которые знают и которым доверяют клиенты, такие как PayPal и Stripe. Это будет стимулировать мгновенную оплату и повысить конверсию клиентов. Совместимость сертификатов SSL: Позвольте вашим клиентам совершать безопасные платежи на вашем сайте, используя последний сертификат SSL для шифрования транзакций, конфиденциальных данных и даже логинов пользователей.
    No work in Website Creation
    Active in Miami, United States
    From €10 for Website Creation
  • yourwebsite.com

    yourwebsite.comcertified-flagverified-flag

    (0 review)
    Начните свою мечту с создания веб-сайта. Ваша мечта начинается здесь. Создайте свой сайт с помощью любого из наших хорошо продуманных шаблонов. Начните создавать портфолио, блог или интернет-магазин без каких-либо навыков программирования или дизайна. Хотите иметь свой интернет-магазин? Начните продавать сегодня. С легкостью создайте свой интернет-магазин и расширьте свой бизнес до новых горизонтов. Он включает в себя корзину покупок, более 35 вариантов оплаты и все функции, необходимые для онлайн-продаж уже сегодня. Придерживайтесь своей мечты! Мы поможем вам расти. Мы предоставляем необходимые веб-приложения, которые помогут вам развиваться и добиться успеха в Интернете, с помощью SSL-сертификатов, SEO, облачного резервного копирования до электронного маркетинга. Выберите мощные инструменты интернет-маркетинга, чтобы повысить взаимодействие с вашей аудиторией. Начните свою мечту с нашим конструктором веб-сайтов: 1. Выберите шаблон Выберите из библиотеки более 200 тем для веб-сайтов, оптимизированных для мобильных устройств. 2. Получите доменное имя Зарегистрируйте отличное имя для своего сайта при подписке или добавьте его позже. 3. Добавьте свой контент Добавляйте фотографии, видео и интересный контент с помощью редактора перетаскивания. 4. Опубликуйте свой сайт Нажмите «Опубликовать», чтобы запустить свой сайт в Интернете. Вах тариф есть хостинг! 05 5. Продвигайте свой сайт Получите доступ к мощным маркетинговым инструментам на нашем рынке дополнений.
    No work in Website Creation
    Active in Miami, United States
    From €5 for Website Creation
  • CREA.

    CREA.certified-flagverified-flag

    (0 review)

    We elevate and cultivate brands

    Welcome to CREA! We create brand positioning strategies and transform them into brand key visuals and website development. Our team is highly experienced in brand strategy, brand psychology, graphic design, website development, and digital customer journeys, and have worked in industries such as fashion, wellness, food, and beverage, electronics, beauty, psychology, and personal brands. If you want a brand that can be also sold in the Latin American market you got to the right agency, as we are also fluent Spanish speakers and have experience working with countries such as Colombia and Mexico. That's why we say CREER PARA CREAR. We Believe in order to Create. We got this! Let this boutique firm cultivate and elevate your brand.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Ingenima

    Ingenimacertified-flagverified-flag

    4.9
    (14 reviews)

    Creamos e impulsamos tu presencia digital

    Recommended
    Somos partners de marcas que rompen el molde. La imagen de una marca, cómo habla y dónde se muestra son universos paralelos que coexisten y forman parte del Multiverso Ingenima. Branding para crear marcas sólidas, Productos Digitales centrados en las personas y Consultoría de Marketing & Google Ads para generar leads con rapidez. Así te ayudamos a crecer. ¡Hagamos equipo!
    5 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • 1000heads

    1000headscertified-flagverified-flag

    4.8
    (2 reviews)

    1000heads is a Social Transformation™ Company

    Recommended
    Award-winner
    🇬🇧 We’re a​ Social Transformation™ Company. We’re on a mission to transform the way brands talk and are talked about. ​ We’re proud to be a strategic partner to some of the very best brands on the planet, helping them stay relevant, conversational, and advocated—all at the speed of social. Today’s fragmented media landscape presents myriad complex new social communications challenges. Brands are held to higher standards of humanness than ever before. That means being good listeners and being in the moment. It means being empathetic, conversational, authentic, and interesting. All this requires a fundamental communications shift—a transformation of priorities, competencies, processes, and activities.​ We’re working with some of the world’s best-known brands as a global strategic partner, building dedicated cross-functional teams across data, strategy, and activation in order to deliver Social Transformation™ to the brands. 🇩🇪 Als Agentur für Social Transformation™ begleiten wir unsere Kunden auf ihrem Weg in die Digitalisierung. Wir helfen ihnen, die Sprache von Social zu sprechen. Und zu gestalten, wie dort über sie gesprochen wird. Social Media erfindet sich jeden Tag neu. Seit über 20 Jahren sind wir strategischer Partner für einige der weltweit bekanntesten Marken, die wir tagtäglich dabei unterstützen, relevant und im Gespräch zu bleiben. Die heutige fragmentierte Medienlandschaft stellt eine Vielzahl komplexer neuer Herausforderungen an Marken. Sie sollen menschlicher sein als je zuvor: Ein guter Zuhörer und passend zum Zeitgeist. Einfühlsam, gesprächig, authentisch und immer interessant. Das erfordert einen grundlegenden Wandel in der Kommunikation – eine Transformation der Prioritäten, Kompetenzen, Prozessen und Marketingaktivitäten. Als globaler strategischer Partner bauen wir maßgeschneiderte, interdisziplinäre Teams in den Bereichen Data, Strategie und Kampagnen-Aktivierung auf, um so Social Transformation™ möglich zu machen.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Koderspedia Solutions

    Koderspedia Solutionsverified-flag

    5
    (4 reviews)

    Creating a Vision for Future

    Recommended
    Award-winner
    Welcome to KODERSPEDIA, your gateway to the world of cutting-edge technology and innovation. We are a dynamic software development company that offers a wide spectrum of services to fuel your digital journey, from custom software development and mobile application design to web design and eCommerce solutions. Our mission is to be your trusted project partner, guiding you towards growth and helping you achieve your goals in the digital landscape. At KODERSPEDIA, we pride ourselves on our expertise in various web technologies, ensuring that you receive top-notch services in web development, mobile app development, SEO, E-Commerce, and a range of design services. Our team of skilled professionals is well-versed in UI/UX design, ensuring that your web and mobile applications not only function flawlessly but also provide an exceptional user experience. In the realm of Web Development, we have earned the coveted top spot for combined development services in our region on Clutch, a testament to our dedication and expertise. But don't just take our word for it – our satisfied clients have shared their experiences through glowing reviews and testimonials. Here's a glimpse of our stellar reputation: ✅ CLUTCH.CO REVIEWS: (5/5 Stars): https://clutch.co/profile/koderspedia#highlights ✅ THUMBTACK REVIEWS: (4.8/5 Stars): https://www.thumbtack.com/ca/palo-alto/web-design/koderspedia-custom-software/service/427573743556763651 ✅ TRUST PILOT REVIEWS: (4.5/5 Stars): https://www.trustpilot.com/review/koderspedia.com?utm_medium=trustbox&utm_source=MicroReviewCount ✅ BBB REVIEWS: (5/5 Stars): https://www.bbb.org/us/ca/palo-alto/profile/computer-software-developers/koderspedia-1216-1528987 We take a structured approach to delivering excellence: A) Design: Our journey begins with design. We craft the overall website design and layout, offering unlimited revisions until you are fully satisfied. We will present you with the website's home page and inner pages design in the form of images, ensuring that you're delighted with the aesthetics. B) Development: The next phase involves development, where we bring your vision to life by creating the website's features and functions as per your specific requirements. We ensure that the functionalities align with your needs. We provide a beta testing link, allowing you to monitor real-time progress, navigate the website, and share your valuable feedback and insights. C) Deployment: In the final phase, we rigorously test the website's performance, ensuring it functions flawlessly. Once you grant approval for the website to go live, we handle the deployment process, making your website accessible on the internet. We provide you with complete backend credentials and rights, ensuring that you have ultimate control over your digital masterpiece. Discover the KODERSPEDIA difference, where innovation meets reliability, and where we transform your digital aspirations into reality. For more information and to explore our extensive portfolio, simply Google "KODERSPEDIA," and all the relevant information about our company will be at your fingertips. Join us on the path to digital excellence!
    7 works in Website Creation
    Active in Miami, United States
    From €500 for Website Creation
  • CydoMedia

    CydoMediacertified-flagverified-flag

    5
    (8 reviews)

    #1 - Award Winning Website Design & Development Agency

    Award-winner
    At CydoMedia Website Design and Development, we specialize in creating beautiful, responsive websites that help businesses in Houston stand out online. Our team of expert designers and developers are dedicated to delivering custom solutions that meet your unique needs and exceed your expectations. Whether you're looking for a new website design, a website redesign, or ongoing website maintenance and support, our team has the skills and experience to help. We use the latest technologies and design trends to ensure that your website is not only visually stunning, but also user-friendly and optimized for search engines. Our services include website design, development, website hosting, maintenance, e-commerce solutions, mobile app development.
    9 works in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • In today’s highly competitive marketplace, hugely disparate agencies are competing against each other. The large global shops tend to focus on their strength as a network and on producing consistent work across it. The smaller agencies focus on being nimble and creative. The truth is that all these qualities are requisite, so an agency has to offer something more. At Young & Rubicam, we have a unique offering that comes out of Y&R’s founding principle that our obligation to clients is to Resist the Usual.The phrase Resist the Usual was coined by Ray Rubicam in 1923. While it comes out of our roots, it’s all about looking forward. It is also about looking outward, so that everything we do is about our clients and their particular challenges and objectives, rather than about ourselves. 
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • DLB Group is a true marketing services integrator. When we say a true integrator, it's not only because we have experts on our staff (commercial architecture, SMS, web design, PR, trade marketing, broadcast and print production, among others). It's also because we generate integrated proposals that preserve the message of the campaign across all media. More importantly, we create impactful plans that support the message among different media, bringing the consumer real marketing experiences and memorable contacts. This is the value of being a DLB Group client. We do what brands need.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Pixel Source

    Pixel Sourcecertified-flag

    (0 review)
     
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • JatApp

    JatAppcertified-flag

    (0 review)
    JatApp is a full-service software development company that drives digital transformation across verticals.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Cole, Scott & Kissane, P.A. – Attorneys At Law | Florida's Leading Defense Firm is a full-service law firm, servicing Miami, Tampa, Orlando, Fort Lauderdale, Bonita Springs, Fort Myers, Key West and Naples.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Specializing in Marketing-conversion driven Website Designs & Graphic Designs. Local Miami Web Design Company. Get More Customers. WordPress Design Experts.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Silva Heeren

    Silva Heeren

    (0 review)

    Your one-stop-shop for graphic design, logo/branding and web design in Miami.

    Silva Heeren is a full-service graphic and web design studio in Miami, with the goal of helping small to medium sized companies build their brand, at a competitive price with a streamlined approach. If you are interested in renewing your company’s image or simply improving an existing design, our team of editors, programmers, and designers will offer you the dedication and quality your project deserves. Our service doesn't stop after your website design, logo creation or brochure production is finished. We will provide you with the correct advice, anything from the right paper stock to the necessary programming language, in order to make your project exceed your customers’ expectations. We will be the art department your company needs, your graphics team outside of your office, just a phone call away.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Alex Tobias

    Alex Tobiascertified-flag

    (0 review)
    Looking for a WordPress web designer? I specialize in building modern, conversion-focused websites for small businesses.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Final Web Design

    Final Web Design

    (0 review)

    Final Web Design: Creating Stunning Online Experiences

    Final Web Design Miami is the Leading Custom Website and Hosting Provider in Miami, Florida. Get your Free Quote
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Krafted Digital

    Krafted Digital

    (0 review)

    Krafted Digital is a Full-Service Digital Marketing Agency.

    Unlock your brand's full potential with Krafted Digital, a premier full-service digital agency in Miami, USA. Elevate your online presence today!
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • webdesign-miami

    webdesign-miamicertified-flag

    (0 review)
    Web design Miami company, 20+ years experience in website design, graphic design & logo design. Small biz and startups. FREE consultation.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Degom Global Marketing

    Degom Global Marketing

    (0 review)

    Using Instagram, Facebook, PPC ads and much more, we give our clients proven results.

    A Digital Marketing agency that specializes in social media and search engine platforms with a constant focus on lead generation and sales. We position our clients for success through social media management services, social media advertising services, Google ads, Microsoft ads, web design, and premium consulting.
    No work in Website Creation
    Active in Miami, United States
    No budget for Website Creation
  • Hoooper

    Hooopercertified-flag

    (0 review)
    Welcome to GoHooper Web Design based in Miami and Nashville. Full service for Web Development, Website Design, Graphic Design, Internet Marketing, SEO & more.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Branding is What We Do

    Branding is What We Do

    (0 review)

    Look better than your competitors. Spend less.

    BRANDING IS WHAT WE DO™ - LOOK BETTER THAN YOUR COMPETITORS. SPEND LESS. GRAPHIC DESIGN | PRINTING | WEB Denver, Colorado Denver's new graphic design and commercial printing partner that lets you outsource your branding material needs without the high fees of creative marketing agencies. BRANDING IS WHAT WE DO™ focuses only on two things...(1) Providing professional-grade graphic design that SELLS and tells your story, and (2) provide low-cost printing for all your branded marketing collateral. Finally, there is one vendor that has the talent and experience to provided amazing results for your brand...all under one roof. We are experts in capturing the attention of your customers through: Corporate branding, logo design, websites that sell, digital ads, custom displays, brochures, business presentations, custom forms, large format printing, custom car wrap design and printing, adhesive vinyl wraps, business cards, corporate identity design, and so much more. Contact us for small or large project based quotes or long-term design and printing outsourcing customized plans.
    No work in Website Creation
    Active in Miami, United States
    From €1000 for Website Creation
  • Website Design company in Miami working globally. Low cost website design, logo design affordable SEO, social media marketing, designing and printing of marketing materials. Wix Partners in Miami. Learn more how we can help you o grow youe business.
    No work in Website Creation
    Active in Miami, United States
    No budget for Website Creation

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Improve promptly your image in Miami thanks to a website developement assignment!

What kind of operations will a web design company develop?

Because the web design companies usually work with companies active in the accounting- and even the household products sector they will, unquestionably, manage to answer all your solicitations. You will hence expeditiously sense that every inquiry can be answered by a firm specialised in website developement in Miami.

If your company is active in the accounting industry or any other industry and looking for a new communication partner specialised in website developement, then your firm already is taking a stride in the right direction. Truly, Sortlist knows all the agencies expert in website developement and will have the means to help your firm meet the perfect agency for your task in website design optimalisation or your task in responsive website creation.

Sortlist helps you find the best agency in Miami

The website, created by Sortlist, supports advertisers who want to find the most skilled marketing bureau for their activity. And since our team has a network enclosing more than 50.000 agencies, we can confirm you that your web design company in Miami doubtlessly is in our list.

Why operate with a web design company in Miami?

What we also speedily can say is that the person who puts resources in a task in website developement with no tools to assess the harvest is foolish. Thus reaching out to a web design company is the best solution to easily measure those outcomes.

Find a web design company in Miami.

us's objective is to formulate an index of the 5 finest web design companies for your operation. And they will hence, due to their talent and expertness, construct quality for your operation in server configuration or responsive website creation. Thus trust us, the bureaus in Miami will have all thing under control.

Say stop to the frustration and unending searching for the best web design company, our company is the fitting service. Send Sortlist your operation straightaway, and our company will help your company in finding the perfect agency.