The 10 Best Social Media Agencies in Florida (2024)

Best Social Media Agencies in Florida

845 providers

Featured providers

  • ABC DIGITAL (by ABCW)

    ABC DIGITAL (by ABCW)certified-flagverified-flagfeatured-flag

    4.6
    (11 reviews)

    Se parte de la Revolución Digital Global

    Recommended
    Award-winner
    ABC Digital es una de las agencias holding de ABCW, contamos con más de 12 años de experiencia en el mercado y contamos con el mejor talento internacional. Hemos sido reconocidos como "la mejor agencia de publicidad internacional" por Merca 2.0. Contamos con más de 200 colaboradores que se encargan de crear estrategias digitales integrales, innovadoras y a la vanguardia de las tendencias globales de marketing digital. Algunos de nuestros servicios son: SEO, gestión y manejo de redes sociales, campañas publicitarias en medios digitales, estrategias de inbound marketing y desarrollo de sitios web, e-commerce, aplicaciones móviles y landing pages con alta experiencia de usuario e interactividad. Algunos de nuestros clientes son: Playa Resorts, EY, Energizer, Maple Bear, Panasonic, entre otros, con los cuales hemos logrado llevar sus resultados a otro nivel. Actualmente somos Google Premier Partners, Meta Business Partners, Hubspot Partners y contamos con acceso a Amazon Web Services, aportando alto valor en las estrategias de cada uno de sus clientes. 🇺🇸 https://abcdigitalagency.us/ 🇲🇽 https://www.abcdigital.mx/ 🇨🇴 https://abcdigital.com.co/
    4 works in Social Media
    Active in Florida, United States
    From €800 for Social Media
  • Web Design Glory

    Web Design Glorycertified-flagverified-flagfeatured-flag

    4.9
    (33 reviews)

    "Rising Brands for Digital Glory!"

    Recommended
    Award-winner
    Web Design Glory is a professional web design and development agency that offers a wide range of services to help businesses establish a strong online presence. Our team of experienced designers and developers works closely with clients to understand their unique needs and create customized solutions that meet their specific requirements. Our services include Website Design, Web Development, Mobile Application, Branding Solutions, Digital Marketing, Domain & Hosting, Video Animation & Content Creation. We specialize in creating modern, responsive websites optimized for search engines and providing a great user experience. Our web development services include e-commerce solutions, content management systems, and custom web applications. At Web Design Glory, we are dedicated to providing high-quality services that deliver results. Contact us today to learn more about how we can help your business succeed online.
    2 works in Social Media
    Active in Florida, United States
    From €186 for Social Media
  • High Results

    High Resultscertified-flagverified-flagfeatured-flag

    (0 review)

    Connecting Worlds

    Award-winner
    Somos comunicación estratégica. relaciones públicas y marketing digital. ¡Apoyamos sus objetivos de negocio! Generamos estrategias de comunicación enfocadas en la visibilidad y recordación de las marcas, productos y servicios para mejorar el posicionamiento frente a las audiencias. Hemos trabajado con cerca de 250 compañías , de la mano de un equipo multidisciplinario y un equipo directivo con más de 23 años de experiencia . Con presencia didrecta en diferentes países de Latinoamérica gracias a nuestra equipo de consultores    
    2 works in Social Media
    Active in Florida, United States
    From €3000 for Social Media
  • WartinLabs

    WartinLabscertified-flagverified-flagfeatured-flag

    5
    (11 reviews)
    Recommended
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Spin

    Spincertified-flagverified-flagfeatured-flag

    5
    (2 reviews)

    Big ideas for small screens!

    Award-winner
    We're an independent agency, creating our own playbook for fast-changing culture. We unleash fast, future-ready creations across organic, paid, creative, influencer and campaign to deliver trackable business results. As a passionate, multi-cultural team of 50+ social media experts we combine data-driven strategy with social-first content. Based in London, operating globally. Trust us to unleash your brand on socials.
    5 works in Social Media
    Active in Florida, United States
    From €3000 for Social Media
  • SuccessLab

    SuccessLabcertified-flagverified-flagfeatured-flag

    5
    (3 reviews)

    Let's Grow Together

    Welcome to SuccessLab, your trusted partner in digital marketing success. At SuccessLab, we are dedicated to empowering small and medium-sized businesses to thrive in the ever-evolving digital landscape. Our mission is simple yet powerful – to help businesses grow and succeed through strategic digital marketing solutions. Our values are honesty, integrity, caring for your business as it's our own and believing in personal relationships.
    2 works in Social Media
    Active in Florida, United States
    From €250 for Social Media

Best Social Media Agencies in Florida

Sort by
  • Absolute Web

    Absolute Webverified-flag

    5
    (2 reviews)
    Award-winner
    Our name really tells you everything you need to know, Absolute Web is a Creative Digital Commerce Agency, established in 1999, providing your business with results in absolutely any aspect of marketing. A highly skilled team comprised of web designers and developers, e-commerce managers, content creators and marketing experts with years of experience in the industry, are ready to grow businesses across many platforms and industries. Led by an entrepreneurial spirit, we treat every client’s business as our own. Taking the time to fully immerse ourselves in their respective industry by identifying competition, trends, failures, and successes is key to working with our clients to developing tailor-made strategies that produce results. Absolute Web is a full-service agency with strong abilities in ecommerce development and management as well as marketing, photography, video and content creation. Based in Miami, we specialize in custom development of Ecommerce Solutions on Magento, Shopify & BigCommerce platforms, informed by strategy and guided by our client’s goals we utilize all of our assets and expertise to ensure results.
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • The Influencer Marketing Factory

    The Influencer Marketing Factoryverified-flag

    5
    (2 reviews)

    The go-to for influencer marketing

    Award-winner
    We’re a team of seasoned marketing professionals with decades of combined experience within the Digital Marketing and Influencer Marketing practice. We have a proven record of successful campaigns and we know how to make any Influencer Campaign work. Our process is simple and effective and our team is passionate and looking to bring your company to the next level.
    1 work in Social Media
    Active in Florida, United States
    From €10000 for Social Media
  • PUSH MEDIA

    PUSH MEDIAverified-flag

    (0 review)
    Award-winner
    What we do   We have a wide range of experience, expertise and tools to create and implement your campaigns, from web development, ecommerce, social media, to carefully curating awesome content to optimising it online with our great SEO and PPC powers, not to mention exceptional social media. The backbone to our strategic process is the data-backed content we create, which has been endlessly researched so it’s the best and most relevant it can be. Our team works hard to ensure that your content is served up like a big juicy steak (vegetarians also welcome), and we aren’t finished until we’ve served a delicious three-course meal that leaves you satisfied.   How We Do It   To get under the skin of your content, we match your project with the team members best-suited to it. We may be in digital marketing but we work human to human, so we’ll work closely with you to really get under the skin of your goals. You’ll notice that we don’t like to overcomplicate things – so we only use technical jargon if we’re going for a triple-word score in Scrabble.   Help Us Help You   Here at PUSH MEDIA we appreciate your goals and understand the confusing and crazy world of digital marketing, meaning we can guide you through the best avenue for your online objectives. If you want to succeed online and you’re ready to explore the options available to you, get in touch! We’d love to hear from you!
    3 works in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Doc Digital SEM

    Doc Digital SEMcertified-flagverified-flag

    5
    (3 reviews)

    Your Digital Marketing Doctor

    Recommended
    Doc Digital SEM is a full-suite digital marketing agency that specializes in Medical Marketing. Our medical marketing agency provides time-tested and proven marketing strategies that work well for new patient acquisition. Let us create a lead generation campaign through top-of-the-line digital marketing campaigns for you! You will love the results, and so will your new patients! Our Digital Marketing for Medical Clinic services are second to none!
    No work in Social Media
    Active in Florida, United States
    From €250 for Social Media
  • Wegacha

    Wegachacertified-flagverified-flag

    5
    (2 reviews)
    Award-winner
    We get it. You have a great business idea, but you’re sitting at your desk thinking, “How the F do I start?” “Who do I call?” “How do I give this idea life?” We get it. Your imagination is running wild. There’s no stopping your thoughts about your idea and how it could change your world. We get it. We were there ten years ago. Tired of our nine-to-five. In our bellies we felt the fire. And we know that a good business take time to grow, There’s a long way to go, from a person with a good idea, to a successful entrepreneur. But don’t worry. Be happy. We got you. We’ve been through this before. We’ve been around the block. And around the world. We’ve seen the good days and the bad days. And now, we’re standing stronger than ever. So, are you ready? We. Are. Going. To. Build. Great. Things. Together. Step by step. Brick by brick. Pixel by pixel. We’re thinkers, dreamers, doers, storytellers and hackers with a cause. That will guide you through this new journey into the digital world. So, let’s get to work! Your dedicated Manager will be with you around-the-clock. We are Team Wegacha We get it. We got you. 
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • We are a Growth Hacking Marketing agency and proud Google Partners. We are passionately obsessed with our clients' ROI and we hack growth by combining creative Pay-Per-Click (PPC) campaigns, Conversion Rate Optimization (CRO), Analytics, and Automation. We are proud to have been featured in Forbes.com and Telemundo.
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • We believe in collaboration, diverse perspectives, pushing the envelope, and clear-cut solutions. And a lot of laughs along the way. We’re the ride-or-die creative team that will always empower you—and tell the truth about what will empower your organization. Our small, agile team is deeply connected. We bring our insight and unique POV to each and every project, as the seats at the LUMI table represent women from the Black and LGBTQIA+ communities. We know everything changes at lightning speed, and we’re here to be your marketing partner (or your marketing department) as your business grows.
    2 works in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • B-1 Digital

    B-1 Digitalverified-flag

    (0 review)

    IS YOUR DIGITAL STRATEGY TAKING YOU WHERE YOU WANT TO BE?

    B-1 Digital is a dynamic digital marketing agency with a proven track record of helping businesses thrive in the ever-evolving digital landscape. Our mission is to empower our clients with innovative and data-driven strategies that drive growth, increase visibility, and boost their bottom line. With a team of experts specializing in digital strategy, advertising, social media, and more, we offer comprehensive solutions tailored to the unique needs of each client. Whether you're a startup looking to establish a strong online presence or an established brand seeking to optimize your digital efforts, B-1 Digital is your strategic partner for success. We're here to transform your digital challenges into opportunities and guide you towards sustainable growth in the digital age. Let us unlock the full potential of your online presence and help you achieve your business objectives.
    2 works in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • 3 Pixels Media

    3 Pixels Mediacertified-flagverified-flag

    5
    (1 review)
    3 Pixels Media es un equipo altamente experimentado de creativos, diseñadores y programadores en constante búsqueda de desafíos para impulsar el entorno digital. En los últimos 9 años, hemos entregado con éxito cientos de aplicaciones de vanguardia, lo que nos ha permitido obtener una gran cantidad de conocimientos y experiencia. El equipo de 3 Pixels Media se enorgullece de su filosofía de desarrollo ágil; Una Metodología Flexible que nos ayuda constantemente a cumplir plazos de entrega cortos a la vez que proporciona a nuestros clientes la máxima flexibilidad y rentabilidad.      
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • LinkingAds

    LinkingAdsverified-flag

    4.7
    (1 review)
    Recommended
    Award-winner
    We’re focused on providing our clients with optimal digital marketing solutions that always result in new generated leads online. Our team is made of carefully picked go-getters who are ready to help you and your business rise above the competition in the search results. What makes us different from all the other agencies is that we are results driven, we are also perfectionists so what ever we do we will make sure it's perfect. Our real-time transparency reporting will always let you know what's going on. 
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • DiBrand

    DiBrandcertified-flagverified-flag

    5
    (1 review)

    Development & Design

    Recommended
    At DiBrand we help companies to contact their customers through digital solutions, design and development. We are passionate about creating experiences, exploring new technologies and making compelling designs.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Watauga Group

    Watauga Groupcertified-flagverified-flag

    (0 review)

    The Advertising Media Specialist for Attractions, Destinations, & Outdoor Brands

    Award-winner
    At Watauga Group, we leverage two decades of advertising media expertise and our love for the outdoors and entertainment to help attractions, destinations, and outdoor brands maximize their sales and elevate advertising ROI. Our deep marketplace intelligence and insights into the media behaviors and preferences of visitors, guests, and outdoor enthusiasts enable us to help drive brand awareness and action at every step of your customer's journey. Watauga’s brand and performance advertising experts navigate today’s complex media landscape to create full-funnel advertising strategies encompassing the most effective mix of digital and traditional media channels, platforms, data, and technologies. Our end-to-end media solutions include Broadcast TV & Radio, OTT & Streaming Audio, Out-of-Home, Digital Display, Paid Search, Paid Social, Sponsorships, and more. Certified by the WBENC, Watauga is one of the largest women-owned media agencies in North America with offices in Orlando, Atlanta, Birmingham, and Nashville. Our client experience includes Smith & Wesson, Dollywood, Campers Inn RV, American Outdoor Brands, The Columbus Zoo & Aquarium, Atlanta Botanical Garden, Visit Panama City Beach, Florida Fish & Wildlife Conservation, and Visit Lake Tahoe, among others. Watauga has also worked with major consumer brand advertisers including GM, The Home Depot, AT&T, Comcast, and Capital One.
    1 work in Social Media
    Active in Florida, United States
    From €10000 for Social Media
  • Sapdra

    Sapdracertified-flagverified-flag

    (0 review)
    SAPDRA is an IT Company located in USA & India, helping businesses by delivering IT services including website design, website development, app development, software development, CRM, e-Commerce development and digital marketing services. Why Sapdra? ISO Certified Company Worldwide Services Quality Services 24X7 Environment Data Security Data Integrity & Reliability Money Return Policy Lifetime Support Trust Worthy Company   Our Vision The highly professional and certified experts at SAPDRA, have this unique vision of placing their clients in the league of digitally developed establishments. We aim at fostering growth in the best possible way in your budget.   Our Services Website Designing Website Development Software Development App Development IT Outsourcing CMS Development Employee Outsourcing Content Writing & PR Digital Marketing
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • What Makes Us Different? We help you to get a Clear Strategy, Build a Brand that set you apart from the competition in your area or niche and generate More Sales. We create hyper-targeted real estate marketing funnels to attract the right leads, automate follow-up campaigns and stay on top of mind with your prospects. We are a marketing agency that helps our clients generate more traffic, leads, and sales. We do this through a strategy tailored to the unique needs of your business including branding, web design, social media, email marketing, PPC, sales enablement, and analytics, with expertise in technology like Databox, HubSpot, Google Analytics, Facebook and other growth-focused solutions.
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • LLIZO MARKETING

    LLIZO MARKETINGcertified-flagverified-flag

    5
    (1 review)
    Llizo Marketing is a boutique full service marketing agency located in Miami, Fl. Llizo has been helping many small, mid sized and large companies achieve the desired sales goals by providing an array of marketing programs that include: Google AdWords, SEO, Social Media marketing, Content marketing & much more.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • BluHorn

    BluHorncertified-flagverified-flag

    5
    (1 review)
    BluHorn® is a web-based media buying software program accessible from any device. It is designed to organize, schedule and report media buys, whether for broadcast TV, cable TV, radio, outdoor or print and digital media. This software, which was created by media buyers for media buyers, was developed with the input of more than 50 small to midsize advertising, marketing and digital media firms throughout the United States. 
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Magnetic Mango is a collaborative startup based in Panama City, FL dedicated to providing services that build visibility, awareness, and trust for our clients. We believe that businesses of all sizes – and budgets – should have the opportunity to access unique solutions to their needs. We’re a team of creative marketing, business development specialists, and reputable freelancers who help our clients produce enhanced, more relevant strategies and tactics. We focus on three pillars to live by, work by, and achieve by : These three pillars form the foundation for everything we do on behalf of our clients. We rely on these values to drive mutual success for our company and theirs. Through honesty, loyalty, and respect, companies of all sizes – and budgets – can have the opportunity to access unique solutions to their needs. When clients succeed, we succeed. Honesty As with any successful partnership, we will always be fully transparent with you. Honesty is the first, most essential of our three core pillars. We will let you know up-front what we’re doing, why and how we’re doing it– and how it’ll affect your bottom line. Loyalty We believe that opportunities are everywhere, and will continually explore new ways to resolve our clients’ needs. We maintain our loyalty by asking relevant questions to seek out the best options for our partnerships. Respect Environments, expectations, targets, goals, ideals– and even budgets– can change. We respect our clients and are flexible enough to change with them.
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Webiance

    Webiancecertified-flagverified-flag

    (0 review)
    Award-winner
    Webiance is a Best Digital Marketing And Web Design Agency Worldwide   Webiance is a Best Digital Marketing and Web Design Agency Worldwide offers Digital Marketing Services, Social Media Services, E-commerce Solutions and Website Designing Services   At Webiance, Our primary objective is to help you build and improve your business. As long-established leaders in the online marketing industry, we have the experience and insight to determine the needs of your company and customers, plan and execute processes to align those needs, and ultimately help you attract, engage and convert more customers. Webiance is a Digital marketing and Web Design Agency based out of United States, Canada, United Kingdom and India. We offer Digital Marketing Services, Website Design, E Commerce Solutions, Search Engine Optimization, Pay Per Click, Social Media Marketing and overall Digital Marketing Services. We are catering to our clients based out of USA, Canada, UK, Singapore, Dubai, New Zealand, Australia and other parts of the World.
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Juno Digital Development is a leading provider of web development and digital marketing services to a wide variety of companies from Fortune 500 companies to start-ups. We are experts in bringing the highest ROI traffic to our clients' websites. We are experts in SEO. We can manage your PPC/Ad Buy marketing to increase from 200-800% the ROAS of your marketing budget. We are also expert developers and have expertise in HTML, CSS, JavaScript, PHP, Java, Ruby on Rails, Magento, WordPress, and Drupal.
    1 work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Recommended
    Summit Advertising is a full-service advertising agency and marketing firm in Boca Raton. Services include traditional advertising, digital marketing, public relations, social media marketing, millennial marketing, media buying, along with creative and production services all dedicated to the  automotive industry . We represent some of the country’s top automotive dealers in the tier 2 and tier 3 space. Our depth of experience will help you “Summit the Mountain” ahead.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • wdmarketingdigital

    wdmarketingdigitalverified-flag

    5
    (1 review)

    Agencia de Desarrollo web, Social Media, Marketing Digital Web development agency, Social Media

    Somos expertos en creación de sistios Web, manejor de redes sociales, campañas de marketing digital, SEO, SEM y mucho más. We are an amazing team, expert on web development, digital marketing campaigns, SEO, SEM and more
    No work in Social Media
    Active in Florida, United States
    From €400 for Social Media
  • Criterion Global

    Criterion Globalcertified-flagverified-flag

    (0 review)

    Innovative growth strategy for ambitious brands.

    Award-winner
    The leading independent, international media buying agency + in-house media consultancy. Technology + Tenacity for a global media marketplace.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Laughing Samurai is an Orlando, FL digital creative agency focused on making advertising entertaining, effective and fun. Specializing in brand development, content creation, digital marketing and award-winning website design/development, the Laughing Samurai team puts high priority on quality creative that impacts individuals and their environment.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • LOOKLIVELUXE Group, lifestyle consulting & marketing services featuring image consulting, interior design and event management based out of Orlando, FL.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Creative Mindworks, a Miami Florida based internationally ranked integrated marketing and advertising firm—solutions driven and Thinking Fresh Daily! For 25 years, our collaborative of inspired individuals has created marketing ideas that deliver. For us, it’s not about how many clients we secure, it’s about how effectively we solve their problems. We achieve results through strategic marketing solutions that are always compelling and fresh. Whether it’s branding, print collateral, traditional advertising or online, we tailor the services we provide to the unique needs of each valued client. Our team understands that great advertising must be accompanied by great results. That’s why we do more than offer marketing services. We create solutions.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Jasmine Sandler

    Jasmine Sandlercertified-flagverified-flag

    (0 review)
    Jasmine Sandler is an awarded Digital Marketing Strategist and Consultant with over 100 successful SEO and Social Media client engagements completed.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • The Original TraDigital Agency - Moore and Scarry Advertising is the nation's largest Tier-3 automotive advertising agency. With 68 employees in Cape Coral, Florida and 30 in Denver, Colorado, our clients enjoy local support with national impact. Boasting 21 Telly Awards, numerous ADDYs and AVAs, our full-service advertising and audiovisual production capabilities are industry proven. We currently represent more than 300 automobile dealers across the country, including dealer groups appearing in the Fortune 500 and Automotive News Top 125. Our portfolio also includes two award-winning digital and social media subsidiaries: DyGen and Sparq.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Envisionworks

    Envisionworkscertified-flagverified-flag

    (0 review)
    ENVISIONWORKS, located in Miami, Florida is a creative digital marketing & branding firm specializing in luxury boutique hotels and resorts, distinctive lifestyle environments and travel-related experiences.   Our destination marketing clients include some of the most notable luxury hotels, resorts and villas affiliated within the  Leading Hotels of the World  and  Small Luxury Hotels of the World portfolios and highly sought after Caribbean travel destinations.   We work with luxury hospitality and lifestyle brands providing marketing enrichment initiatives which are personalized to articulate each individual story.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • SMBsocial

    SMBsocialcertified-flagverified-flag

    (0 review)
    SMBsocial is an Inbound Marketing software company that provides Digital Presence Solutions to SMB’s, helping them to solve business problems with creative applications and platforms. “We create Digital Ecosystems that enable businesses to extend their reach into the digital world.”
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Above Promotions is a digital publicity, marketing and promotions agency in Tampa, FL that specializes in driving stories and interactions for food, fashion and family brands.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • On Tap Growth

    On Tap Growthcertified-flagverified-flag

    (0 review)
    We are global Creative Marketing and Advertising agency with the mission to help brands, enterprises and startup companies to connect, engage and retain their potential customers. Unlocking business growth for every entrepreneur. Creative business growth solutions we offers: Design Branding - Creatives Design/Logo Design,  Brochure designs | Digital marketing Banner ads & rich media ads,  Brand Marketing & Communication Solutions Brand Activation & Brand Experience,  Media Planning & BuyingVideo Production and Promotion, Mobile Marketing Strategy | Mobile Advertising Mobile AppsPay Per Click Advertising Online and Offline PR | Contextual Advertising | Social CRM Social Apps and Fan  Social Media Campaigns & Marketing Messaging  | multiple touch points based communications | Integrated marketing Campaigns |Online Presence Enhancement
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Outsmart Labs

    Outsmart Labscertified-flagverified-flag

    (0 review)
    Outsmart Labs is a strategic digital agency with a passion for helping brands meet their business goals with ground-breaking tactics.  Our clients want to grow, scale, and position themselves as leaders in their space. For that reason, innovation and experimentation are crucial to our promise.   Our mission : Develop digital strategies and innovative solutions to achieve our clients online business goals as efficiently and seamlessly as possible. Together, we all share one mission: forward movement.   Our Capabilities :   - Digital Agency  - Social Media Management: Facebook, Twitter, Google+, Instagram, Yelp, Foursquare and many more.   - Content Marketing: Blog articles, Newsletters, Webinars   - Affiliate Marketing Management   - Paid Advertising: SEM/ SEO/ Adwords campaigns   - Website Development   - Integrated Marketing Strategies  We understand and value the importance of small businesses and are willing to work with budgets of all sizes! Don't hesitate to contact us at needhelp@outsmartlabs.com  For more information on the impact of social media on businesses and how you can increase sales simply by being online, check out our blog http://outsmartlabs.com/blog/
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Spectra Studio

    Spectra Studiocertified-flagverified-flag

    (0 review)
    Website Design ☆ Logo Design ☆ Social Media Marketing > Logo Design and Branding Packages > Website Design Packages: Sample OnRouteTowing . ca or DezinerOptix . com > Website Video Spokesperson Packages > Search Engine Optimization Packages > Social Media Marketing Packages > Website and Email Hosting Packages Spectra Studio is a leading graphic design company rated highly in the design industry for creative web graphic design solutions , brand identity, web design, and website development. We are a world-renowned graphic design company bringing all design experts in the field to work and achieve excellent results for your design needs. Our graphic design team specializes in building brand recognition to ensure that your company or product stands apart from your competition. From small start-up companies in need of logo design and branding collaterals such as brochures and business cards to Medium and Large Companies searching for the right web design and development agency to handle their complete web design solution and marketing campaign -- Spectra Studio will deliver!!
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • art&mkt llc

    art&mkt llcverified-flag

    (0 review)
    STRATEGY, MARKETING AND ADVERTISING Taking care of your business communication and product to optimize results. We are in the business of creating and developing brands and products. Our biggest commitment is the result. Always innovative, fast and specific solutions for our clients. Both online or offline.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • YOU HAVE 3 SECONDS TO ENGAGE WITH YOUR AUDIENCE whom will you trust this important task? DIGITAL INNOVATION MARKETING SPECIALISTS FOCUSED ON THE PROFITABILITY OF YOUR BUSINESS
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • We are a web design and marketing firm with offices in Tallahassee, Florida and Mobile, Alabama. We specialize in helping small business create a complete online presence for their business, from developing a strong visual brand to devising effective strategies for social media marketing. Our agency is unique because we are small on purpose! Each of our clients gets personal service from one of the agency's partners, including our cell phone numbers. Because of the relationships we develop with our clients and our deep experience in our field, we are able to achieve outstanding results and help our clients surpass their marketing goals. 
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  •   As India’s premium business process management services provider, Tata Business Support Services is a wholly owned subsidiary of Tata Sons, the holding company of the 142 years old Tata Group – India’s most reputed brand. Inspiring trust and un-complicating business transformations since 2004, Tata BSS is driven by the value of simplicity and serve companies that want to increase their customer base, retain high value customers, protect their brand reputation and become more efficient. Business Info :  With state-of-the-art facilities across 19 delivery centres in 15 locations & powered by Over 11000 PILOTS (Preparing Innovative Leaders of Tomorrow), Tata Business Support Services provides customer lifecycle management, digital marketing, Business analytics & research, HR/payroll, procurement and IT services for a growing community of 46+ industry leading customers spread across USA, Europe and Asia. 
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Latin Market in the USA and Latin America. Hablamos español.   DIGITAL PLANNING & STRATEGY Digital Marketing Strategy Campaign Planning and Creations Analytics and Reports WEB / APPS DEVELOPMENT Web Design and Programming App IOS/Android development Creative Services DIGITAL MEDIA BUYING Digital Planning Media Buying Mobile Ads SOCIAL MEDIA Community Management Social Campaigns SEO & Geolocation Reports and Analytics DIGITAL DESIGN Logo / Corporate Identity UX / UI Interface Video and Animation Digital Signage DIGITAL INNOVATION CONSULTING Small Business Innovation Consulting Digital Innovation Marketing Strategic Innovation
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Perconvly Media

    Perconvly Mediacertified-flagverified-flag

    (0 review)
    Ecommerce Scaling Company for Proven Stores doing more than $15,000/month in Revenue. We focus on delivering High ROAS. Paid Media and Acquisition Experts, Digital Media Buyers testing and scaling products through Facebook Advertising, Native Advertising, Google Adwords and more. Conversion Rate Optimization Experts delivering  We scaled a brand from $32,000/month to $530,000/month in under 2 years From $110,000/month to $185,000/month From $2MM per year to $4.3MM in under one year
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Grand Brand & Co is a design boutique that specializes in brand ideation and management. We also offer brand strategy, messaging, social media, visual design, and business consulting. At Grand Brand & Co, we know first impressions are lasting. Branding in the 21st century involves technical skill and creative impulse. Branding, strategy and digital presence have become a language of their own, and yes we’re fluent. Through creating a unique brand, we work together to translate your company’s message into the visual languages of the future.   We understand every business is unique, and if yours isn’t, We make it so.  From drafting to launch, our team is fully engaged.  That means anything from social media management, brand positioning, to market analysis.  We’re a team of artists with a head for business.   Let’s work together and create one-grand-brand.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Forums inc.

    Forums inc.verified-flag

    (0 review)
    Hello! We’re Forums Corporate Event Planning.   We’d like to share with you: Who we are What we do What we can do for you Our leaders had a dream. 18 years later, here we are. Forums Corporate Event Planning is led by Alex Peña, our Founder and President, and her daughters, Ali Peña, CEO, and Pilar Peña, Director of Finance & Accounting.  The company was founded in the year 2000 in a shared office space with only one account and a dream. Since then, we’ve grown into an international corporate event planning agency, servicing every major market in the Americas. Just name it. We’ll plan it. Whether you need an impactful presence at a tradeshow or the flawless coordination of a conference, we can work with you to create events that reflect your brand, engage your clients, impress your business colleagues and motivate your employees. Seminars & Conferences Tradeshows Road Shows Product Launches Sales Trainings Customer Appreciation Events Executive Retreats Incentive Travel Sporting Tournaments Team-Building Events Press Conferences Grand Openings VIP Dinners Awards Banquets Theme Parties Holiday Parties Company Picnics Charity Functions Virtual Events Webinars The Americas? Within our reach. Based in Miami, headquarters of the Americas, we leverage our expertise and regional resources to produce corporate events in every major market, from New York to Argentina. We understand the nuances, from local business practices to the subtleties of language. We count on an extensive network of suppliers and our experienced local teams to plan events regionally and execute locally. It’s not just what we do, but how we do it. At Forums, we’re dedicated to providing you with great customer service. First, we make sure we’re on the same page. Then, we stay one step ahead of you, triple check everything, and deal quickly with any challenges that come up. We manage your budget  carefully and remain at your service to help with whatever you may need. Budget & timeline management                 Guest speakers Promotional giveaways Printing Press activities Social media Event app management Photography Videography Feedback surveys Post-event communications Venue negotiation Food & beverage selections Event website Invitations RSVP calls Online & onsite registration Airfare & accommodations Transportation Audiovisual production We’ll let our clients tell you. DELLEMC   “THANK YOU for your support prior to and during these events. They were a total success. You did an extraordinary job.” INTEL  “You’re definitely a service-oriented company. We had a short time to pull this one off, but you went the extra mile and even kept a smile on your faces. Great job!” SAP “I only have positive things to say about your team. The level of professionalism, flexibility and expertise that you provide to us are excellent.” TURNER  “Thanks again for all your help on this project. Your team is great! Always available and quick to get back to me!” ELECTROLUX  “Thanks to you and your team for all the hard work on the event. It turned out incredible. Thank you for your professionalism! BANCO SANTANDER  “Wanted to send you a quick note to say thank you for your help on last week’s events. We’ve received great feedback and are very satisfied.”   Webinar service Within our portfolio of services is the planning and execution of WEBINARS, combining LOGISTICS AND PREPARATION of it with CALLS to the target market. We have specialized resources to achieve EXCELLENT RESULTS and we adapt to YOUR REQUIREMENTS. We take care you Creation of Invitations, Art and Design: Design of HTML invitations with unlimited corrections and link to the registration page of each webinar.   Email blast: Several e-blasts are made to the entire contact base; One at the beginning, two during the process of invitation to the webinar and another the day before the same as a reminder   Coordination of presenters: Schedule the presenters who should be chosen by the client and confirm them a month before the presentation   Execution through different platforms: Adobe Connect, Cisco Webex or any platform that the client requires. Surveys to determine leads. This is a key element therefore it should be easy to understand, clear and concise. The fewer fields you include, the more answers you'll get. Recording the webinar and sending recording link to previously registered participants. Final attendance report. Follow up of leads, through telephone calls, if the client requests it.  Forums can do for you more than you can imagine!
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • PUSH MEDIA

    PUSH MEDIAcertified-flagverified-flag

    (0 review)
    Why Hire Push Media? We will help you sell more of your product or service through our PUSH MEDIA Advertising that allows your brand to be in front of more people so they can listen and buy more from you.   We are a ‘Push Media’ business with an established pedigree in emerging technology, social media management, and web design & development.   The first thing we will do is create a clear brand message so that people will listen and buy more from you.    Sounds easy, doesn´t it?  Well, it is.   But most Fortune 500 firms miss the mark on clearly communicating their message to their clients. We employ an Expected Results Methodology where we guarantee success with every marketing campaign. What does success mean? Success means that we will guarantee to add a number of clients to your existing business using your Website and Marketing Campaigns that work (The number of clients that we will add to your business will be based on the nature of your business).   We are not going to give away our secret formula, however, we will give you the opportunity to schedule a complimentary 15 minute Skype Call with Rommel Pravia, so you can find out for yourself why you need to hire us as your go to Marketing Guru! Here is the calendar link to make finding time easy, click on the link below and follow the instructions.   Invest In Your Business Skype call   See you at the other side!   Rommel Pravia CEO of PUSH MEDIA & Founder of The Mastermind Business & Marketing Course
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Octal IT Solution

    Octal IT Solutioncertified-flagverified-flag

    (0 review)

    Offshore IT Solutions

    Octal IT Solution is an ISO 9001:2015 Certified Company with its physical presence in the USA, UK, India, Singapore & Dubai, and serving its clients across the globe. Established in the year 2004, Octal IT Solution has developed more than 1,100 Mobile and Web Apps for over 700 clients from all parts of the world. With a team of 150+ seasoned professionals, we offer innovative solutions from our well-established development centers as well as through onsite work environments. With top-notch & affordable solutions, Octal IT Solution has earned notable associations from technology leaders like Microsoft, NASSCOM, Amazon Web Services, Acquia, STPI, D&B and many more. We are appreciated by hundreds of clients on AppFutura, Clutch, GoodFirms, AppLancer, Appdexa, and Extract, consistently being among the Top-10 Mobile App Developers on these platforms. GoodFirms Listed Octal IT Solution as the best web design solutions, giving organizations in a survey of global web design companies, was conducted among 200+ web design agencies adjoining with freelance web designers. Octal IT Solutions specializes in fantasy Sports and E-Wallet App Development, delivering cutting-edge technology solutions for modern digital transactions and gaming experiences.  
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • M & M Multimedia LLC is a full service media and marketing company located in Fort Myers, Florida. Specializing in content marketing to boost your SEO, SEM, PPC, Social Media, Mobile, and Email Marketing. Whether you need video production with an edge, web development that distinguishes, or interactive design to engage users, our creative team can give your customers the content they crave. Once your media content is produced we help ensure your message reaches your target audience. Our media planning expertise encompasses traditional advertising and marketing channels through T.V. commercials, radio ads, and print, plus we also excel in the complex realms of online marketing. All this means less cost for you since there no need to mark-up subcontracted work like some of our competitors, and your brand message will stay consistent throughout various marketing channels. Contact us today to discuss your next exciting project. We guarantee you will love our work and like working with our team.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Your Creative Services Agency Our team thrives on creativity and coming up with real-solutions for brands. Utilizing a skill-set of graphic design, copywriting, web-development, research, and digital strategy, we create custom, integrated marketing campaigns based on business goals that communicate value, build community, and get results for brands. 
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Gig Miami

    Gig Miamiverified-flag

    (0 review)
    Award-winner
      We are experts in the branding and e-commerce field, with a holistic focus on fashion, lifestyle, and wellness specialized brands. Our ambition is to cultivate a highly successful and integral brand experience to meet all of your business needs. At Gig Miami, we believe your business goals should be in alignment with well-crafted and effective digital communication. It is our promise to you that all of the services you require to promote your brand will be provided with expertise, love, and dedication that stands the test of time.   64% of consumers say that shared values are the main reason that they have a trusted relationship with a brand. Do you know if your website and marketing materials are truly aligned with your brand’s values? Running marketing campaigns or employing new strategies without getting your branding right first is like shouting at a brick wall. Why? Because your ideal customers aren’t going to listen if your brand doesn’t resonate with them. Branding is everything in business - especially in fashion. When done right, it allows you to connect with your ideal customers who identify with your brand values and aesthetic.   My expertise is to help brands create a beautiful visual identity with compelling messaging that communicates their brand’s values and connects them with their ideal customers, all without the big price tag that often comes along with it. If you’re open to learning more, let’s talk. Book a call with me and receive a free brand audit: https://calendly.com/gigmiami   Services,    Web design. Design and develop a website using Modern fonts. Up to 6 designed Squarespace pages Custom CSS added Responsive design Basic SEO added to website Graphics   Responsive E-commerce Design Design and develop a Flagship E-commerce Customized design for a unique brand experience Custom CSS Responsive design SEO added to website Curated Images & Graphics We have a strong experience with Shopify, Magento...   Full Branding Experience Brand Strategy Logo design Copywriting - Mission, Vision, Values Social media graphics, newsletter design, business cards Brand guideline PDF
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • Attrock

    Attrockcertified-flagverified-flag

    (0 review)
    Partner with Attrock - the results-driven digital marketing company that big brands like HubSpot, BigCommerce, GetResponse, IMH, ShaneBarker.com, and Semrush trust.   We’ve successfully helped our clients : 🔎Rank for 5,000+ keywords on page 1 of Google 💸Generate $4 for every $1 spent on our marketing strategies 🎯Drive 128% more leads and conversions 🚀Increase monthly website traffic to 300K+ Generate $160K earned media value 📈Scale an agency from 5-figure to 7-figure income in just two years   Our digital marketing services include but are not limited to : SEO | Content Marketing | Influencer Marketing | Online PR | Lead Generation | Landing Page Optimization | Affiliate Marketing | Email Marketing | Podcast Launch   Join forces with our marketing gurus to drive more revenue!
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • OmniDigit

    OmniDigitcertified-flagverified-flag

    (0 review)
    Amidst the chaos and noise out there on perhaps all digital platforms, getting heard might be challenging for your business. We understand this challenge, and therefore, implement data-driven, strategic initiatives to help improve your brand. Your business is unique. Therefore, the growth strategy should be tailored too. OmniDigit is a growth hacking and digital marketing consulting firm that helps businesses achieve scalable and sustainable growth. We offer Growth Hacking, Digital Marketing, Business Consulting, Marketing Consulting, Content Marketing, SEO, Online Advertising, Social Media Marketing, Email Marketing, web design, and Branding as a service for business growth. Check out our consulting and growth services. You can always chat or talk to us to help us better understand your business stage and goals.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media
  • IPS USA

    IPS USAcertified-flagverified-flag

    (0 review)
    Before selecting a BPO services provider, keep in mind the following points to come to a better decision. Moreover, working with IPS USA, you stand to achieve these benefits comprehensively. 1. Better Focus on What You Can Do Better Many tasks do not have a direct impact on your profitability; however, most of these low profitability tasks are crucial to the performance of core operations. Some of these tasks may require specialized knowledge and experience, like legal services or medical billing services; others may be rudimentary and anyone can perform it with just a little education or training, like data entry. Still, other tasks may only need to activate once a year, like the annual audits of various departments. Outsourcing your functions like customer service calls, digital marketing, mobile app development, sales, and social media marketing is not only an affordable method but often turns out to be revenue generating. 2. Economies of Scale Due to Lean Operations Speaking of efficiency, when you take the help of a BPO services provider to perform one of your functions, it can give tremendous results due to economies of scale. As an excellent business process outsourcing firm, IPS USA has specialized staff dedicated to specific functions and there are separate teams working on different projects. Additionally, we also have specialized equipment and software technology to aid in the tasks which can be expensive for an individual organization. Consequently, few of our regular clients ask us to perform a range of services on their behalf consistently. Years of performing related tasks, repeatedly, has given us the experience and efficiency to shine for them. 3. Increased Return on Investment (ROI) Handing over the non-core activities to us will not just improve your productivity in the core competency areas, but reduce the overall expenses as well. It will generate high sales and quick conversions for you since we carry expertise in customer relationship management, software development, digital marketing, medical billing, claims submission and health IT management in general. Therefore, you benefit from multiple angles and use every aspect of our business to grow your business exponentially. 4. Safe and Secure Data When we enter into a contract with a client for performing tasks on their behalf, we exchange essential business information or user data. We use such information only for legitimate purposes according to contractual and legal limitations. As a company policy, we adhere to all the US and International legal requirements as applicable in maintaining a users’ data confidentiality. Furthermore, we have invested in state-of-the-art technologies and equipment to make sure that appropriate organizational, technological, and procedural safety measures are set in place as mandated by the relevant US and International laws. BPO services in line with the law of the land are what every client wants as a priority. 5. Reduced Legal Burden While subcontracting business operations to business process outsourcing companies does not absolve firms of all legal burdens and responsibilities, it certainly reduces the liability. IPS USA, as a BPO firm, understands the legal obligations in letter and spirit. We make sure that the contracts elaborate our responsibility down to the minute details. After the contract finalizes, we stick to every word of the agreement to the best of our abilities. The List of Services IPS USA delivers excellent BPO services to a wide range of industries. The BPO solution definitely holds on and sticks until the end. Some of the services we offer include – • Customer Relationship Management • Outsourcing Sales Services • Full-Scale Digital Marketing Services • Search Engine Optimization • PPC Management Services • Social Media Marketing • Web and Mobile Application Development • Custom Software Development • HR Portal Development and Management • Telemarketing • Medical Coding and Billing Services • Medical Billing Software – RCM Solutions • Cloud Services       Share Your Project Details and Get a Free Estimate You can reach us at info@ipsusa.net or through this number  1-909-245-6251 . The social media pages of Facebook, Twitter, and LinkedIn always respond to your queries. Do follow us on LinkedIn – https://www.linkedin.com/company/information-process-solution/ and get a grip on your business activity.
    No work in Social Media
    Active in Florida, United States
    From €1000 for Social Media

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Keep your social media marketing task in Florida on a tight rein!

Sortlist helps you find the best agency in Florida

There is a profuseness of bureaus in social media marketing, but nothing but one is ideal for you. Our skills makes it possible to meet the perfect associate out of all these firms. Meeting the suitable firm is starting from now straightforward.

Working with our social media agencies, a certain gain!

Have faith in the skills and the hints of your social media agency throughout the launch of your operation and your task will have a undeniable impact on your business. This is thanks to  the fact that they have grow into gurus in their expertise and social media marketing has zero secrets for them!

In that way will a social media agency aid you? And what is social media marketing?

A large list of solutions is proposed by social media agencies, for instance social media accountmanagement and social media communication. Thus don't hesitate anymore and call those bureaus through our algorithm, and your company will have the means to set up your project quickly.

To be rewarding in, for example, an assignment in social media communication or in social media accountmanagement, is cooperating with a competent company in social media marketing of superior importance. And your company surely comprehends that there is a mountain of competent agencies like that globally. Thus keep things simple and contact us.

Please don't sit on fence to call Sortlist and commence digging up a social media agency and its collaborators in the household products and accounting sector. Once your business has met the most skilled company that meets your prerequisites, your assignment will hastily be ready to be started.

Meet the most accomplished social media agency for your future marketing operation.

Whether it is your primary cooperation with a social media agency or not, it remains of fundamental importance to dig up the ideal collaborator. And your company is able to doubtlessly do this with our service. Finding an agency that meets all your solicitations in social media communication or social media marketing is this day straightforward.